Host taxon 10090
Protein NP_780345.1
RING finger protein 122 isoform 4
Mus musculus
Gene Rnf122, UniProt Q8BP31
>NP_780345.1|Yersinia pseudotuberculosis IP 32953|RING finger protein 122 isoform 4
MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIAGPTETSQSIGILLDELV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.68 | -0.682779164244169 | 0.039 | 28096329 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)