Bacterial taxon 273123
Protein WP_002210329.1
ribosome silencing factor
Yersinia pseudotuberculosis IP 32953
Gene rsfS, UniProt Q66DE7
>WP_002210329.1|Yersinia pseudotuberculosis IP 32953|ribosome silencing factor
MQGKALQEFVIDKLDDLKGQDIIALDVQGKSSITDCMIICTGTSTRHVMALADNVVQESRAAGMIPLGIEGQGVSDWIVVDLGEVIVHVMQEESRRMYELEKLWS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.98 | 1.98488083102415 | 4.8e-13 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.73 | 1.73094536331221 | 8.9e-14 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.66 | 1.65766352923626 | 4.6e-10 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.56 | 1.55710012762214 | 4.1e-19 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Retrieved 4 of 1 entries in 0.9 ms
(Link to these results)