Host taxon 10090
Protein NP_084374.2
ribonuclease K6 precursor
Mus musculus
Gene Rnase6, UniProt Q9D244
>NP_084374.2|Yersinia pseudotuberculosis IP 32953|ribonuclease K6 precursor
MVVDLPRYLPLLLLLELWEPMYLLCSQPKGLSRAHWFEIQHVQTSRQPCNTAMRGVNNYTQHCKQINTFLHESFQNVAATCSLHNITCKNGRKNCHESAEPVKMTDCSHTGGAYPNCRYSSDKQYKFFIVACEHPKKEDPPYQLVPVHLDKIV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.72 | -0.720152038092948 | 0.011 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)