Host taxon 10090
Protein NP_031511.1
rho-related GTP-binding protein RhoD isoform 1
Mus musculus
Gene Rhod, UniProt P97348
>NP_031511.1|Yersinia pseudotuberculosis IP 32953|rho-related GTP-binding protein RhoD isoform 1
MNASQVAGEEAPQSGHSVKVVLVGDGGCGKTSLMMVFAKGAFPESYSPTVFERYNATLQMKGKPVHLQIWDTAGQDDYDRLRPLFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNNLRKKRLEPVTYHRGHDMARSVGAVAYLECSARLHDNVEAVFQEAAEVALSSRRHNFWRRITQNCCLAT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.4 | -1.40273790011293 | 4.7e-5 | 28096329 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)