Host taxon 10090
Protein NP_766200.1
rho-related GTP-binding protein Rho6 precursor
Mus musculus
Gene Rnd1, UniProt Q8BLR7
>NP_766200.1|Yersinia pseudotuberculosis IP 32953|rho-related GTP-binding protein Rho6 precursor
MKERRAPQPVVVRCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETMDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSETSIHSIFRTASMVCLNKSSPVPPKSPVRSLSKRLLHLPSRSELISTTFKKEKAKSCSIM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.62 | 2.62023360082449 | 1.5e-11 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)