Host taxon 10090
Protein NP_001288230.1
rho GDP-dissociation inhibitor 2 isoform 1
Mus musculus
Gene Arhgdib, UniProt Q61599
>NP_001288230.1|Yersinia pseudotuberculosis IP 32953|rho GDP-dissociation inhibitor 2 isoform 1
MTEKDAQPQLEEADDDLDSKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDVPVVADPTVPNVTVTRLSLVCDSAPGPITMDLTGDLEALKKDTFVLKEGIEYRVKINFKVNKDIVSGLKYVQHTYRTGMRVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLTWEWNLAIKKDWTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.67 | 0.66524593544088 | 0.014 | 28096329 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)