Host taxon 10090
Protein NP_035384.1
retinol-binding protein 1
Mus musculus
Gene Rbp1, UniProt Q00915
>NP_035384.1|Yersinia pseudotuberculosis IP 32953|retinol-binding protein 1
MPVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRAEGVICKQVFKKVH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.4 | 2.40173963329537 | 2.9e-30 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)