Host taxon 10090
Protein NP_077188.1
reticulon-4 isoform C
Mus musculus
Gene Rtn4, UniProt Q99P72
>NP_077188.1|Yersinia pseudotuberculosis IP 32953|reticulon-4 isoform C
MDDQKKRWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAKIPGLKRKAE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.17 | 1.17446480016631 | 3.8e-7 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)