Host taxon 10090
Protein NP_079853.1
required for excision 1-B domain-containing protein isoform 1
Mus musculus
Gene Rex1bd, UniProt Q9CYZ6
>NP_079853.1|Yersinia pseudotuberculosis IP 32953|required for excision 1-B domain-containing protein isoform 1
MLTAATEVLAAADGPGSAESAWAWRDAPIATLVQRIQQLQNERAQAFRRLDQAHRQYLLSGQHYDFPSYRSVVHEVTQAFAAASREVLAVEAELAGPRAQPVLARHVRSLQELEQTRLATVALLQVMGTPGVSEQDPEKLHQLKIKVIKTMEAIGEVLQELRFDAESAE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.18 | -1.17618452468498 | 0.0012 | 28096329 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)