Bacterial taxon 273123
Protein WP_011192836.1
replication initiation negative regulator SeqA
Yersinia pseudotuberculosis IP 32953
Gene seqA, UniProt Q667R7
>WP_011192836.1|Yersinia pseudotuberculosis IP 32953|replication initiation negative regulator SeqA
MKTIELDEELYRYIASHTQHIGESASDILRRMLKFTAGQPVTDLPVSGAAVKVTAQPAPRDRVRAVRELLLSDEYAEQSRAVNRFMLVLSTLYTLDAQAFTEATESLHGRTRVYFAGDQQTLLQHGTHTKPKHVPGTPFWVITNTNTERKRSMVQHIMLAMQFPPELTDKVCGTI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.4 | -1.3973251300693 | 6.5e-5 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.12 | -1.11710648142932 | 0.024 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.09 | -1.08638636728232 | 0.021 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.06 | -1.0597890548039 | 0.0088 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.9 ms
(Link to these results)