Host taxon 10090
Protein NP_080694.1
regulator of G-protein signaling 10
Mus musculus
Gene Rgs10, UniProt Q9CQE5
>NP_080694.1|Yersinia pseudotuberculosis IP 32953|regulator of G-protein signaling 10
MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPEGVQRFREFLKKEFSEENVLFWLACEDFKKTEDRKQMQEKAKEIYMTFLSNKASSQVNVEGQSRLTEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKPKRTEEEEEEPPDAQTAAKRASRIYNT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.85 | -0.849535041681819 | 0.0014 | 28096329 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)