Host taxon 10090
Protein NP_033075.1
regulated endocrine-specific protein 18 precursor
Mus musculus
Gene Resp18, UniProt P47939
>NP_033075.1|Yersinia pseudotuberculosis IP 32953|regulated endocrine-specific protein 18 precursor
MQSSLKPAGSGHLQLLVCFLLLYSRPGSCSDINAHDGQGQVGSEQLWTFQGLIASVFQYLQLIFHQIVPEGMFWADDIAYELMTKKVEHLSRLHPQYPCRKDMKAVSPTANAGVRSKQEEKLQLLSPQKSPTVKVNRDRCFTTKVIPKATKQEATHPTKGFFGPFPTVGLNLVAD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.88 | -1.88407616563965 | 0.0026 | 28096329 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)