Host taxon 10090
Protein NP_080604.2
regenerating islet-derived protein 4 precursor
Mus musculus
Gene Reg4, UniProt Q9D8G5
>NP_080604.2|Yersinia pseudotuberculosis IP 32953|regenerating islet-derived protein 4 precursor
MASKGVRLLLLLSWVAGPEVLSDILRPSCAPGWFYYRSHCYGYFRKLRNWSHAELECQSYGNGSHLASVLNQKEASVISKYITGYQRNLPVWIGLHDPQKKQLWQWTDGSTNLYRRWNPRTKSEARHCAEMNPKDKFLTWNKNGCANRQHFLCKYKT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.81 | -1.80777038709314 | 1.4e-22 | 28096329 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)