Host taxon 10090
Protein NP_035390.1
regenerating islet-derived protein 3-gamma preproprotein
Mus musculus
Gene Reg3g, UniProt O09049
>NP_035390.1|Yersinia pseudotuberculosis IP 32953|regenerating islet-derived protein 3-gamma preproprotein
MLPRITITIMSWMLLSCLMLLSQVQGEVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.26 | 1.25740549034932 | 9.9e-10 | 28096329 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)