Host taxon 10090
Protein NP_062384.1
receptor activity-modifying protein 3 precursor
Mus musculus
Gene Ramp3, UniProt Q9WUP1
>NP_062384.1|Yersinia pseudotuberculosis IP 32953|receptor activity-modifying protein 3 precursor
MKTPAQRLHLLPLLLLLCGECAQVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSEFIVYYESFTNCTEMETNIMGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEVLIPLIAVPVVLTVAMAGLVVWRSKHTDRLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.9 | 1.89938282289709 | 0.027 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)