Host taxon 10090
Protein NP_058590.1
receptor activity-modifying protein 1 isoform 1 precursor
Mus musculus
Gene Ramp1, UniProt Q9WTJ5
>NP_058590.1|Yersinia pseudotuberculosis IP 32953|receptor activity-modifying protein 1 isoform 1 precursor
MAPGLRGLPRCGLWLLLAHHLFMVTACRDPDYGTLIQELCLSRFKENMETIGKTLWCDWGKTIQSYGELTYCTKHVAHTIGCFWPNPEVDRFFIAVHHRYFSKCPISGRALRDPPNSILCPFIALPITVTLLMTALVVWRSKRTEGIV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.81 | -1.81256055161117 | 2.7e-7 | 28096329 | |
Retrieved 1 of 4 entries in 0.5 ms
(Link to these results)