Host taxon 10090
Protein NP_766001.1
ras-related protein Rap-2c
Mus musculus
Gene Rap2c, UniProt Q8BU31
>NP_766001.1|Yersinia pseudotuberculosis IP 32953|ras-related protein Rap-2c
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.6 | 0.60120196808802 | 0.0093 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)