Host taxon 10090
Protein NP_082988.1
ras-related protein Rap-2b
Mus musculus
Gene Rap2b, UniProt P61226
>NP_082988.1|Yersinia pseudotuberculosis IP 32953|ras-related protein Rap-2b
MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.78 | 0.7801769331879 | 0.0018 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)