Host taxon 10090
Protein NP_775589.1
ras-related protein Rab-8B
Mus musculus
Gene Rab8b, UniProt P61028
>NP_775589.1|Yersinia pseudotuberculosis IP 32953|ras-related protein Rab-8B
MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSSGAGGPVKITESRSKKTSFFRCSLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.06 | 1.06471684561808 | 4.3e-8 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)