Host taxon 10090
Protein NP_033029.2
ras-related protein Rab-4A
Mus musculus
Gene Rab4a, UniProt P56371
>NP_033029.2|Yersinia pseudotuberculosis IP 32953|ras-related protein Rab-4A
MAQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVLILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFMQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRTQAPSAQECGC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.32 | -1.32267452092104 | 0.00043 | 28096329 | |
Retrieved 1 of 2 entries in 2.2 ms
(Link to these results)