Host taxon 10090
Protein NP_001311460.1
ras-related protein Rab-3D
Mus musculus
Gene Rab3d, UniProt P35276
>NP_001311460.1|Yersinia pseudotuberculosis IP 32953|ras-related protein Rab-3D
MASASEPPASPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFTAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDIICDKMNESLEPSSSPGSNGKGPALGDTPPPQPSSCSC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.83 | -0.831377397937261 | 0.00063 | 28096329 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)