Host taxon 10090
Protein NP_064304.1
ragulator complex protein LAMTOR3
Mus musculus
Gene Lamtor3, UniProt O88653
>NP_064304.1|Yersinia pseudotuberculosis IP 32953|ragulator complex protein LAMTOR3
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKVVEVS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.67 | 0.671100566911337 | 0.022 | 28096329 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)