Host taxon 10090
Protein NP_079930.1
RAD52 motif-containing protein 1
Mus musculus
Gene Rdm1, UniProt Q9CQK3
>NP_079930.1|Yersinia pseudotuberculosis IP 32953|RAD52 motif-containing protein 1
MAELISFVVPTQSDKVLLVWDLSTGPPAEALSHSLFTVFSQFGLLYSVRVFPNAAVARPGFYAIIKFYSSRDAQRAQKACDGKPLFQTSPVKVRLGTRHKALQHQAFALNSSRCQELANYYFGFSGWSKRIIKLQELSGLEDAALAVPMQKGSPQFLCAVEVVLPPYGCRSPGVGISEEPLRQLEEGQSSFLMKRKTAQKLAFQAAVSDAFQKLTIVVLESGRIAVEYRPTAEDLDARSEEELQNLIQVSCSSWSQSSQREEECLSDFSLEEEDLKLCDPH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.81 | -0.81275579297333 | 0.0099 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)