Host taxon 10090
Protein NP_001278088.1
rab effector Noc2 isoform 2
Mus musculus
Gene Rph3al, UniProt Q768S4
>NP_001278088.1|Yersinia pseudotuberculosis IP 32953|rab effector Noc2 isoform 2
MADTIFSSGNDQWVCPNDRQLALRAKLQTGWSVHTYQTEKQRRSQCLSPGELEIILQVIQRAERLDILEQQRIGRLVERLETMQRNVMGNGLSQCLLCGEVLGFLGSSSVFCKDCRKLGIRWLQHFLESLLILNRDLTCSL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.31 | -1.30544033656204 | 0.0016 | 28096329 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)