Bacterial taxon 273123
Protein WP_002210741.1
quinolinate synthase NadA
Yersinia pseudotuberculosis IP 32953
Gene nadA, UniProt Q66D87
>WP_002210741.1|Yersinia pseudotuberculosis IP 32953|quinolinate synthase NadA
MSEIFDVNAAIYPFPARPVPLDTNEKAFYREKIKTLLKQRDAVLVAHYYTDPEIQALAEETGGCVADSLEMARFGNNHPASTLLVAGVRFMGETAKILNPEKKVLMPTLNAECSLDLGCPVDEFTAFCDSHPDRTVVVYANTSAAVKAKADWVVTSSIAVELIEHLDSLGEKIIWAPDRHLGSYVQKKSGADVLCWQGACIVHDEFKTQALARMKALYPDAAVLVHPESPQAVVDMADAVGSTSQLIQAAKTLPQKTLIVATDRGIFYKMQQACPDKELFEAPTAGEGATCRSCAHCPWMAMNGLRAIAEGLEQGGVMHEIHVDEELRQQALIPLNRMLDFANQLKLQVKGNA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.16 | 2.16210809500273 | 1.7e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.58 | 1.5835551190108 | 3.7e-6 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.43 | 1.43354961327104 | 0.0014 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.42 | 1.42179495870618 | 0.00013 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Retrieved 4 of 1 entries in 1 ms
(Link to these results)