Host taxon 10090
Protein NP_001019892.2
pyrin and HIN domain-containing protein 1-like
Mus musculus
Gene Ifi214, UniProt A0A0R4J1R5
>NP_001019892.2|Yersinia pseudotuberculosis IP 32953|pyrin and HIN domain-containing protein 1-like
MVNEYKRIVLLTGLMGINDHDFRMVKSLLSKELKLNKMQDEYDRVKIADLMEDKFPKDAGVVQLIKLYKQIPGLGDIANKLKNEKAKAKRKGKGKRKTAAKRQRQEEPSTSQPMSTTNEDAEPESGRSTPDTQVAQLSLPTASRRNQAIQISPTIASSSGQTSSRSSETLQSIIQSPETPTRSSSRILDPPVSPGTAYSSAQALGVLLATPAKVIKARN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.96 | 2.95814623366761 | 4.2e-6 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)