Host taxon 10090
Protein NP_598782.1
pyridoxine-5'-phosphate oxidase
Mus musculus
Gene Pnpo, UniProt Q91XF0
>NP_598782.1|Yersinia pseudotuberculosis IP 32953|pyridoxine-5'-phosphate oxidase
MTCGLLSVTVTFRRPAKWTGYLRHLCCRGAVMDLGPMRKSYRGDREAFEETHLTSLDPMKQFASWFDEAVQCPDIGEANAMCVATCTRDGKPSARMLLLKGFGKDGFRFFTNYESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEKEAENYFHSRPKSSQIGAVVSRQSSVIPDREYLRKKNEELGQLYQDQEVPKPEYWGGYILYPQVMEFWQGQTNRLHDRIVFRRGLATGDSPLGPMTHHGEEDWVYERLAP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.27 | -1.27455664629172 | 2.7e-9 | 28096329 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)