Host taxon 10090
Protein NP_079833.1
Purkinje cell protein 4-like protein 1
Mus musculus
Gene Pcp4l1, UniProt Q6W8Q3
>NP_079833.1|Yersinia pseudotuberculosis IP 32953|Purkinje cell protein 4-like protein 1
MSELNTKTPPAANQASDPEEKGKPGSIKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDSSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.18 | -2.17604520152154 | 3.1e-6 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)