Host taxon 10090
Protein NP_079623.1
protein yippee-like 3 isoform a
Mus musculus
Gene Ypel3, UniProt P61237
>NP_079623.1|Yersinia pseudotuberculosis IP 32953|protein yippee-like 3 isoform a
MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.61 | 0.606091723986674 | 0.023 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)