Host taxon 10090
Protein NP_899072.1
protein Wfdc21 precursor
Mus musculus
Gene Wfdc21, UniProt Q8BTE6
>NP_899072.1|Yersinia pseudotuberculosis IP 32953|protein Wfdc21 precursor
MKLGAFLLLVSLITLSLEVQELQAAVRPLQLLGTCAELCRGDWDCGPEEQCVSIGCSHICTTN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 6.16 | 6.1613249125927 | 1.4e-16 | 28096329 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)