Host taxon 10090
Protein NP_001074696.1
protein stum homolog
Mus musculus
Gene Stum, UniProt Q0VBF8
>NP_001074696.1|Yersinia pseudotuberculosis IP 32953|protein stum homolog
MEPLHKDAETAAAAAAVAAADPRGASSSSGVVVQVREKKGPLRAAIPYMPFPVAVICLFLNTFVPGLGTFVSAFTVLCGARTDLPDRHVCCVFWLNIAAALIQVLTAIVMVGWIMSIFWGMDMVILAISQGYKDQGIPQQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.42 | -1.41889278481221 | 0.00077 | 28096329 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)