Host taxon 10090
Protein NP_001268781.1
protein S100-A9
Mus musculus
Gene S100a9, UniProt P31725
>NP_001268781.1|Yersinia pseudotuberculosis IP 32953|protein S100-A9
MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 7,62 | 7.61846991576671 | 7,9e-86 | 28096329 | |
Retrieved 1 of 2 entries in 1,2 ms
(Link to these results)