Host taxon 10090
Protein NP_038678.1
protein S100-A8
Mus musculus
Gene S100a8, UniProt P27005
>NP_038678.1|Yersinia pseudotuberculosis IP 32953|protein S100-A8
MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 6.91 | 6.91328497949374 | 3.9e-94 | 28096329 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)