Host taxon 10090
Protein NP_035443.1
protein S100-A6
Mus musculus
Gene S100a6, UniProt P14069
>NP_035443.1|Yersinia pseudotuberculosis IP 32953|protein S100-A6
MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.33 | 1.32702201917648 | 3.4e-13 | 28096329 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)