Host taxon 10090
Protein NP_033139.3
protein S100-A13
Mus musculus
Gene S100a13, UniProt Q545H7
>NP_033139.3|Yersinia pseudotuberculosis IP 32953|protein S100-A13
MAAETLTELEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLKDVGSLDEKMKTLDVNQDSELRFSEYWRLIGELAKEVRKEKALGIRKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.68 | -0.681827987334053 | 0.022 | 28096329 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)