Host taxon 10090
Protein NP_058020.1
protein S100-A11
Mus musculus
Gene S100a11, UniProt P50543
>NP_058020.1|Yersinia pseudotuberculosis IP 32953|protein S100-A11
MPTETERCIESLIAVFQKYSGKDGNNTQLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNCDGQLDFQEFLNLIGGLAIACHDSFIQTSQKRI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2 | 2.00382417848202 | 4.5e-15 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)