Host taxon 10090
Protein NP_001078970.1
protein phosphatase 1 regulatory subunit 3D
Mus musculus
Gene Ppp1r3d, UniProt A2AJW4
>NP_001078970.1|Yersinia pseudotuberculosis IP 32953|protein phosphatase 1 regulatory subunit 3D
MSKGSGSAPLPSTPGSRKLVPRSLSCLSDMDRRPCRPPGCDPRLRPIIQRRSRSLPTSPERRAKAAGAPGAACGAGCNRQVRVRFADALGLELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLQCLVPDFSPPIETPGFGERLARQLVCLERVTCSDLGISGTVRVRNVAFEKQVTVRYTFSGWRSAHEAVARWRGPAGAEGTEDIFAFGFPVPPFLLELGSQVHFALRYGVAGAEYWDNNDGRDYSLTCRSHALHMPRGECEESWIHFI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.66 | 2.66158555539194 | 2.7e-6 | 28096329 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)