Host taxon 10090
Protein NP_081518.1
protein phosphatase 1 regulatory subunit 35 isoform 1
Mus musculus
Gene Ppp1r35, UniProt Q9D8C8
>NP_081518.1|Yersinia pseudotuberculosis IP 32953|protein phosphatase 1 regulatory subunit 35 isoform 1
MMGFGASALESIEGEEALEVPGPPPEPRAPEPRAPEPEPGLDLSLSPSPLPESPKARKSSPGQRKGRRGGSRRGRQVRFQLAPPSPVRSEPLLVAGAPGDDHELEAPALQSSLALSLELQNARAAVASGQFDASKAVEEQLRKSFRTRCALEETVAEGLNVPRSKRLYRDLVSLQVPEEQVLNAALREKLAMLPPQPRAPPLKEVLGPGPDMTMLCNPDSLWSESPHLTVDGLPPLRLQARPRPSEDTFLMHRMLRRWEA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.18 | -1.17690523436207 | 0.037 | 28096329 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)