Host taxon 10090
Protein NP_001300899.1
protein phosphatase 1 regulatory subunit 1B isoform 2
Mus musculus
Gene Ppp1r1b, UniProt Q60829
>NP_001300899.1|Yersinia pseudotuberculosis IP 32953|protein phosphatase 1 regulatory subunit 1B isoform 2
MLFRVSEHSSPEEEASPHQRTSGEGHHPKSKRPNPCAYTPPSLKAVQHLQTISNLSENQASEEEDELGELRELGYPQEDDEEDEDEEEDEEEDSQAEVLKGSRGTVGQKPTCGRGLEGPWERPPPLDEPQRDGNSEDQVEGRATLSEPGEEPQHPSPP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.84 | -0.84107289594183 | 0.022 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)