Host taxon 10090
Protein NP_473390.1
protein odd-skipped-related 2 isoform 2
Mus musculus
Gene Osr2, UniProt Q91ZD1
>NP_473390.1|Yersinia pseudotuberculosis IP 32953|protein odd-skipped-related 2 isoform 2
MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPAAVDHLQGLYGLSAVQTMHMNHWTLGYPSVHEITRSTITEMAAAQGLVDARFPFPSLPFATHLFHPKQGAIAHVLPALHKDRPRFDFANLAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLNPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQTSSPTAASSAAKCSGETAICGGTA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.78 | -2.77779118597781 | 1.4e-10 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)