Host taxon 10090
Protein NP_001333441.1
protein mono-ADP-ribosyltransferase PARP11 isoform 2
Mus musculus
Gene Parp11, UniProt Q8CFF0
>NP_001333441.1|Yersinia pseudotuberculosis IP 32953|protein mono-ADP-ribosyltransferase PARP11 isoform 2
MKQMNLVTGKQRLIKRAPFSISAFSYICENEAIPMPTHWENVNPDVPYQLVSLQNQTHEYNEVASLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGVHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.17 | 1.16963492646393 | 5.8e-7 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)