Host taxon 10090
Protein NP_080583.3
protein CutA isoform 1 precursor
Mus musculus
Gene Cuta, UniProt Q9CQ89
>NP_080583.3|Yersinia pseudotuberculosis IP 32953|protein CutA isoform 1 precursor
MNWGRAPGVLLGGGATLLLSFLWMPALLPVASRLLLLPRALLSMASGSPPSQPPPASGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTEFVRSVHPYEVAEVIALPVEQGNPPYLHWVHQVTESVSNSGTALP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.75 | -0.748953963687226 | 0.018 | 28096329 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)