Host taxon 10090
Protein NP_001334337.1
protein crumbs homolog 3 isoform 2
Mus musculus
Gene Crb3, UniProt Q8QZT4
>NP_001334337.1|Yersinia pseudotuberculosis IP 32953|protein crumbs homolog 3 isoform 2
MATPGLGVLLAFGLPMLPSGWSLTAPDPFTNSTTQPPGDESNGGLSSGAIVAITVVFSILGVLLIAVGLFLLMRKLREKRQTEGTYRPSSEEQFSHAAAEARAPQDSKEPVRGCLPI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.85 | -0.854653997076449 | 0.016 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)