Host taxon 10090
Protein NP_038563.1
protein C10
Mus musculus
Gene Grcc10, UniProt O35127
>NP_038563.1|Yersinia pseudotuberculosis IP 32953|protein C10
MASASAQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPASGSSVAAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.87 | -0.873055979261609 | 0.00071 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)