Host taxon 10090
Protein NP_001008705.1
protein BUD31 homolog isoform 2
Mus musculus
Gene Bud31, UniProt Q6PGH1
>NP_001008705.1|Yersinia pseudotuberculosis IP 32953|protein BUD31 homolog isoform 2
MPKVKRSRKAPPDGWELIEPTLDELDQKMREELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.92 | 0.915975676365619 | 0.0054 | 28096329 | |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)