Host taxon 10090
Protein NP_001103703.1
protein BEX3 isoform a
Mus musculus
Gene Bex3, UniProt Q9WTZ9
>NP_001103703.1|Yersinia pseudotuberculosis IP 32953|protein BEX3 isoform a
MANVHQENEEMEQPLQNGQEDRPVGGGEGHQPAANNNNNNHNHNHNHHRRGQARRLAPNFRWAIPNRQMNDGLGGDGDDMEMFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.93 | 0.932253774185259 | 0.02 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)