Host taxon 10090
Protein NP_001074889.1
protein Abitram
Mus musculus
Gene Abitram, UniProt Q80ZQ9
>NP_001074889.1|Yersinia pseudotuberculosis IP 32953|protein Abitram
MEELRCPEAKLAPPEVVIATEAPPPSLVDRYFTRWYKADVKGKPCEDHCILQHSNRICVITLAGSHPVLQSGKAIQRISYQISNNCSRLENKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTISSCVRGRLMEVNENILHQPSLLQEKPSTEGYIAVVLPKFEESKSVTEGLLTQQQYEEVVVKRTNATATTP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.7 | 0.69796860708631 | 0.044 | 28096329 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)