Host taxon 10090
Protein NP_083907.3
protein ABHD14B
Mus musculus
Gene Abhd14b, UniProt E9QN99
>NP_083907.3|Yersinia pseudotuberculosis IP 32953|protein ABHD14B
MAGVDQHEGTIKVQGQNLFFRETRPGSGQPVRFSVLLLHGIRFSSETWQNLGTLQRLAEAGYRAVAIDLPGLGRSKEAAAPAPIGEPAPGSFLAAVVDTLELGPPVVISPSLSGMYSLPFLVAPGSQLRGFVPVAPICTDKINAVDYASVKTPALIVYGDQDPMGSSSFQHLKQLPNHRVLVMEGAGHPCYLDKPDEWHKGLLDFLQGLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.78 | -1.77998779347083 | 2.8e-18 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)