Host taxon 10090
Protein NP_079858.2
prostamide/prostaglandin F synthase
Mus musculus
Gene Prxl2b, UniProt Q9DB60
>NP_079858.2|Yersinia pseudotuberculosis IP 32953|prostamide/prostaglandin F synthase
MNVVDLGRVGACVLKHAVTGEAVELRSLWQEKACVVAGLRRFGCMVCRWIAQDLSNLRSILDQHDVRLVGVGPEALGLQEFLDGGYFSGELYLDESKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFIQKSPGDYVPQENILQALGISAEVCSSKPPQCDEEVCGR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.7 | -2.70173839634637 | 5.9e-7 | 28096329 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)