Host taxon 10090
Protein NP_084300.1
proline-rich protein 15
Mus musculus
Gene Prr15, UniProt Q9D1T5
>NP_084300.1|Yersinia pseudotuberculosis IP 32953|proline-rich protein 15
MADSGGSSPWWKSLTRKKSKEVTVGVQPQVRPETGQEPSPPHSDRTSSLPENQHSNILGDPGESLRSDKLCEEKTGNSRRNLKISRSGRFKEKRKMRATLLPEGDKSPEEADFPDDPQEDKQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.84 | -2.83876978774168 | 2.4e-41 | 28096329 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)